5-Lipoxygenase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25601125UL

Catalog No. NB394703

Description

5-Lipoxygenase Polyclonal specifically detects 5-Lipoxygenase in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: 5-Lipoxygenase
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: 5-lipoxygenase, 5-LO, 5-LOX, 5LPG, arachidonate 5-lipoxygenase, arachidonic 5-lipoxygenase alpha-10 isoform, arachidonic 5-lipoxygenase delta-10-13 isoform, arachidonic 5-lipoxygenase delta-13 isoform, arachidonic 5-lipoxygenase delta-p10 isoform, arachidonic acid 5-lipoxygenase, EC 1.13.11, EC 1.13.11.34, leukotriene A4 synthase, LOG5, MGC163204
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ALOX5
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWY
• Quantity: 25 μL
• Research Discipline: Cancer, Cholesterol Metabolism, Lipid and Metabolism, Neuroscience, Signal Transduction
• Gene ID (Entrez): 240
• Target Species: Human
• Isotype: IgG

For Research Use Only