Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
5-Lipoxygenase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | 5-Lipoxygenase |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
5-Lipoxygenase Polyclonal specifically detects 5-Lipoxygenase in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| 5-Lipoxygenase | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cholesterol Metabolism, Lipid and Metabolism, Neuroscience, Signal Transduction | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 240 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWY | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| 5-lipoxygenase, 5-LO, 5-LOX, 5LPG, arachidonate 5-lipoxygenase, arachidonic 5-lipoxygenase alpha-10 isoform, arachidonic 5-lipoxygenase delta-10-13 isoform, arachidonic 5-lipoxygenase delta-13 isoform, arachidonic 5-lipoxygenase delta-p10 isoform, arachidonic acid 5-lipoxygenase, EC 1.13.11, EC 1.13.11.34, leukotriene A4 synthase, LOG5, MGC163204 | |
| ALOX5 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title