53BP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25867725UL

Catalog No. NB403145

Description

53BP2 Polyclonal specifically detects 53BP2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: 53BP2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: apoptosis-stimulating protein of p53, 2, ASPP2P53BP2,53BP2apoptosis-stimulating of p53 protein 2, Bbp, Bcl2-binding protein, p53-binding protein 2, p53BP2, PPP1R13A, Renal carcinoma antigen NY-REN-51, tumor protein p53 binding protein, 2, tumor protein p53-binding protein, 2, Tumor suppressor p53-binding protein 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TP53BP2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TISVPSYPSKSASVTASSESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDNSPNLQNNPEEPNPEAPHVLDVYLE
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cancer, DNA Repair, Tumor Suppressors
• Gene ID (Entrez): 7159
• Target Species: Human
• Isotype: IgG

For Research Use Only