Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP255054

A-RAF Antibody, Novus Biologicals™
SDP

Catalog No. NBP255054 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP255054 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP255054 Supplier Novus Biologicals Supplier No. NBP255054
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

A-RAF Polyclonal specifically detects A-RAF in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen A-RAF
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias ARAF1A-RAF, EC 2.7.11, EC 2.7.11.1, Oncogene ARAF1, PKS, PKS2A-Raf proto-oncogene serine/threonine-protein kinase, Proto-oncogene A-Raf, Proto-oncogene A-Raf-1, Proto-oncogene Pks, RAFA1, Ras-binding protein DA-Raf, serine/threonine-protein kinase A-Raf, v-raf murine sarcoma 3611 viral oncogene homolog, v-raf murine sarcoma 3611 viral oncogene homolog 1
Gene Symbols ARAF
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDS
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Protein Kinase, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 369
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.