Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. A20/TNFAIP3 Antibody, Novus Biologicals™

A20/TNFAIP3 Antibody, Novus Biologicals™
SDP

Catalog No. NB392856 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392856 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB392856 Supplier Novus Biologicals Supplier No. NBP26885725UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

A20/TNFAIP3 Polyclonal antibody specifically detects A20/TNFAIP3 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen A20/TNFAIP3
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias A20TNFA1P2, EC 3.4.19.12, EC 6.3.2.-, MGC104522, MGC138687, OTU domain-containing protein 7C, OTUD7CMGC138688, Putative DNA-binding protein A20, TNF alpha-induced protein 3, tumor necrosis factor alpha-induced protein 3, tumor necrosis factor inducible protein A20, tumor necrosis factor, alpha-induced protein 3, Zinc finger protein A20
Host Species Rabbit
Immunogen This A20/TNFAIP3 Antibody was developed against a recombinant protein corresponding to amino acids: AEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREV
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Inflammation, Innate Immunity, Necroptosis, Neurodegeneration, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 7128
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.