Learn More
Description
Specifications
Specifications
| Antigen | A20/TNFAIP3 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | A20TNFA1P2, EC 3.4.19.12, EC 6.3.2.-, MGC104522, MGC138687, OTU domain-containing protein 7C, OTUD7CMGC138688, Putative DNA-binding protein A20, TNF alpha-induced protein 3, tumor necrosis factor alpha-induced protein 3, tumor necrosis factor inducible protein A20, tumor necrosis factor, alpha-induced protein 3, Zinc finger protein A20 |
| Host Species | Rabbit |
| Immunogen | This A20/TNFAIP3 Antibody was developed against a recombinant protein corresponding to amino acids: AEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREV |
| Purification Method | Protein A purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
