Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AADACL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
| Antigen | AADACL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17931820
|
Novus Biologicals
NBP17931820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179318
|
Novus Biologicals
NBP179318 |
100 μL |
Each for $499.50
|
|
|||||
Description
AADACL1 Polyclonal specifically detects AADACL1 in Human, Mouse samples. It is validated for Western Blot.Specifications
| AADACL1 | |
| Polyclonal | |
| Rabbit | |
| NP_848887 | |
| 57552 | |
| Synthetic peptide directed towards the middle region of human Aadacl1The immunogen for this antibody is Aadacl1. Peptide sequence LQALDFNTPSYQQSMNTPILPRHVMVRYWLDYFKGNYDFVEAMIVNNHTS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| AADACL1, EC 3.1.1.79, KIAA1363EC 3.1.1, NCEHArylacetamide deacetylase-like 1EC 3.1.1.-, neutral cholesterol ester hydrolase 1 | |
| NCEH1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title