AAMDC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156786

Catalog No. NBP156786

Description

AAMDC Polyclonal specifically detects AAMDC in Human samples. It is validated for Western Blot.

Specifications

• Antigen: C11orf67
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: adipogenesis associated, Mth938 domain containing, C11orf67, chromosome 11 open reading frame 67, CK067, FLJ21035, hypothetical protein LOC28971, MGC3367, PTD015
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Pig: 100%; Canine: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H7C9
• Gene Symbols: AAMDC
• Immunogen: Synthetic peptides corresponding to C11ORF67 The peptide sequence was selected from the middle region of C11ORF67. Peptide sequence SEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHST.
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 28971
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.