Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ABC2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15687620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15687620 20 μL
NBP156876 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15687620 Supplier Novus Biologicals Supplier No. NBP15687620UL

Rabbit Polyclonal Antibody

ABC2 Polyclonal specifically detects ABC2 in Human samples. It is validated for Western Blot.

Specifications

Antigen ABC2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8ND04
Gene Alias ABC2, Amplified in breast cancer gene 2 protein, chromosome 17 open reading frame 71, FLJ10587, protein SMG8, Protein smg-8 homolog, SMG8
Gene Symbols SMG8
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C17ORF71 The peptide sequence was selected from the middle region of C17ORF71 (NP_060619). Peptide sequence HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF.
Molecular Weight of Antigen 110 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 55181
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.