ABCA4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP317333100UL

Catalog No. NB169741

Description

ABCA4 Polyclonal antibody specifically detects ABCA4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: ABCA4
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: ABC10, ABCRRMP, ARMD2DKFZp781N1972, ATP binding cassette transporter, ATP-binding cassette sub-family A member 4, ATP-binding cassette transporter, retinal-specific, ATP-binding cassette, sub-family A (ABC1), member 4, ATP-binding transporter, retina-specific, CORD3, EC 3.6.3, FFMFLJ17534, photoreceptor rim protein, retinal-specific ATP-binding cassette transporter, retina-specific ABC transporter, RIM ABC transporter, RIM protein, RmP, RP19, Stargardt disease protein, STGD, STGD1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEET
• Quantity: 100 μg
• Research Discipline: ABC Transporters, Lipid and Metabolism, Vision
• Gene ID (Entrez): 24
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified