Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABCA5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
| Antigen | ABCA5 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15980920
|
Novus Biologicals
NBP15980920UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159809
|
Novus Biologicals
NBP159809 |
100 μL |
Each for $499.50
|
|
|||||
Description
ABCA5 Polyclonal specifically detects ABCA5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ABCA5 | |
| Polyclonal | |
| Rabbit | |
| Protein Phosphatase | |
| ABC13, ATP-binding cassette A5, ATP-binding cassette sub-family A member 5, ATP-binding cassette, sub-family A (ABC1), member 5, DKFZp451F117, DKFZp779N2435, EC 3.6.3, EC 3.6.3.25, EC 3.6.3.41, EST90625, FLJ16381, KIAA1888 | |
| ABCA5 | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Q8WWZ7 | |
| 23461 | |
| Synthetic peptides corresponding to ABCA5(ATP-binding cassette, sub-family A (ABC1), member 5) The peptide sequence was selected from the C terminal of ABCA5. Peptide sequence HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title