Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABCA8 Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP316046100UL
This item is not returnable.
View return policy
Description
ABCA8 Polyclonal antibody specifically detects ABCA8 in Human, Rat samples. It is validated for Western BlotSpecifications
ABCA8 | |
Polyclonal | |
Western Blot 1:500 - 1:2000 | |
ATP-binding cassette sub-family A member 8, ATP-binding cassette, sub-family A (ABC1), member 8, EC 3.6.3, EC 3.6.3.41, KIAA0822MGC163152 | |
Recombinant fusion protein containing a sequence corresponding to amino acids 425-495 of human ABCA8 (NP_009099.1). NEYGHRRPPLFFLKSSFWSQTQKTDHVALEDEMDADPSFHDSFEQAPPEFQGKEAIRIRNVTKEYKGKPDK | |
100 μg | |
Primary | |
Human, Rat | |
Purified |
Western Blot | |
Unconjugated | |
PBS, 50% glycerol, pH7.3 | |
Rabbit | |
Affinity purified | |
RUO | |
10351 | |
Store at -20°C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction