Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ABCA8 Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$148.20 - $378.00

Specifications

Antigen	ABCA8
Dilution	Western Blot 1:500 - 1:2000
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB167188 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP31604620UL	20 μg	Each for $148.20	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB167187 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP316046100UL	100 μg	Each for $378.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ABCA8 Polyclonal antibody specifically detects ABCA8 in Human, Rat samples. It is validated for Western Blot

Specifications

Antigen	ABCA8
Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human, Rat
Gene Alias	ATP-binding cassette sub-family A member 8, ATP-binding cassette, sub-family A (ABC1), member 8, EC 3.6.3, EC 3.6.3.41, KIAA0822MGC163152
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 425-495 of human ABCA8 (NP_009099.1). NEYGHRRPPLFFLKSSFWSQTQKTDHVALEDEMDADPSFHDSFEQAPPEFQGKEAIRIRNVTKEYKGKPDK
Primary or Secondary	Primary
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.

Dilution	Western Blot 1:500 - 1:2000
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Formulation	PBS, 50% glycerol, pH7.3
Gene ID (Entrez)	10351
Isotype	IgG
Purification Method	Affinity purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ABCA8 Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

Specifications

Description

Specifications

Documents