ABI2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25601425UL

Catalog No. NB394702

Description

ABI2 Polyclonal specifically detects ABI2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ABI2
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: Abelson interactor 2, Abi-2, ABI2B, abl binding protein 3, abl interactor 2, Abl-binding protein 3, AblBP3ABI-2, abl-interacting protein 1 (SH3-containing protein), abl-interactor 2, abl-interactor protein 2b, AIP-1, arg protein tyrosine kinase-binding protein, Arg-binding protein 1, argBP1, ARGBPIA, argBPIB, SSH3BP2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10152
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ABI2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHT
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only