Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABI2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | ABI2 |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ABI2 Polyclonal specifically detects ABI2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
ABI2 | |
Polyclonal | |
Rabbit | |
Human | |
Abelson interactor 2, Abi-2, ABI2B, abl binding protein 3, abl interactor 2, Abl-binding protein 3, AblBP3ABI-2, abl-interacting protein 1 (SH3-containing protein), abl-interactor 2, abl-interactor protein 2b, AIP-1, arg protein tyrosine kinase-binding protein, Arg-binding protein 1, argBP1, ARGBPIA, argBPIB, SSH3BP2 | |
ABI2 | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
10152 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHT | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title