Learn More
Description
Specifications
Specifications
| Antigen | ABL2 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | Abelson murine leukemia viral (v-abl) oncogene homolog 2, Abelson murine leukemia viral oncogene homolog 2, Abelson-related gene protein, Abelson-relatedgene), arg tyrosine kinase, EC 2.7.10, EC 2.7.10.2, FLJ22224, FLJ31718, FLJ41441, tyrosine-protein kinase ABL2, Tyrosine-protein kinase ARG, v-abl Abelson murine leukemia viral oncogene homolog 2 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSF |
| Purification Method | Protein A purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
