Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ABRO Antibody, Novus Biologicals™
SDP

Catalog No. NBP156788 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156788 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP156788 Supplier Novus Biologicals Supplier No. NBP156788
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

ABRO Polyclonal specifically detects ABRO in Human samples. It is validated for Immunoprecipitation, Western Blot.

Specifications

Antigen ABRO
Applications Immunoprecipitation, Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunoprecipitation
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q15018
Gene Alias Abraxas brother protein 1, ABRO1abraxas brother 1, Em:AC068896.4, family with sequence similarity 175, member B, FLJ22338, KIAA0157BRISC complex subunit Abro1, Protein FAM175B
Gene Symbols ABRAXAS2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to KIAA0157 The peptide sequence was selected from the middle region of KIAA0157. Peptide sequence GDSGEDSDDSDYENLIDPTEPSNSEYSHSKDSRPMAHPDEDPRNTQTSQI.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23172
Test Specificity This product is specific to Subunit or Isoform: Abro1.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.