ACAA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154746

Catalog No. NBP154746

Description

ACAA2 Polyclonal specifically detects ACAA2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ACAA2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 3-ketoacyl-CoA thiolase, mitochondrial, Acetyl-CoA acyltransferase, acetyl-CoA acyltransferase 2, acetyl-Coenzyme A acyltransferase 2, beta ketothiolase, beta-ketothiolase, DSAEC, EC 2.3.1, EC 2.3.1.16, FLJ35992, FLJ95265, Mitochondrial 3-oxoacyl-CoA thiolase, mitochondrial 3-oxoacyl-Coenzyme A thiolase, T1
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P42765
• Gene Symbols: ACAA2
• Immunogen: Synthetic peptides corresponding to ACAA2(acetyl-Coenzyme A acyltransferase 2) The peptide sequence was selected from the N terminal of ACAA2. Peptide sequence ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10449
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Yeast, Zebrafish
• Isotype: IgG