ACAD9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18274925UL

Catalog No. NB433343

Description

ACAD9 Polyclonal specifically detects ACAD9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: ACAD9
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated
• Gene Accession No.: Q9H845
• Gene Symbols: ACAD9
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EILRMYIALTGLQHAGRILTTRIHELKQAKVSTVMDTVGRRLRDSLGRTVDLGLTGNHGVVHPSLADSANKFEENTYCFGRTVETLL
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 28976
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ACAD-9, acyl-CoA dehydrogenase family member 9, mitochondrial, acyl-CoA dehydrogenase family, member 9, acyl-Coenzyme A dehydrogenase family, member 9, EC 1.3.99, EC 1.3.99.-, EC 1.3.99.10, FLJ23533, MGC14452, NPD002
• Host Species: Rabbit
• Molecular Weight of Antigen: 69 kDa
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only