Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACAT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | ACAT |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180547
|
Novus Biologicals
NBP180547 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP18054720
|
Novus Biologicals
NBP18054720UL |
20 μL | N/A | N/A | N/A | ||||
Description
ACAT Polyclonal specifically detects ACAT in Human samples. It is validated for Western Blot.Specifications
| ACAT | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| ACACT, ACACT1, ACAT-1, ACATACAT1, acyl-Coenzyme A: cholesterol acyltransferase, Acyl-coenzyme A:cholesterol acyltransferase 1, Cholesterol acyltransferase 1, EC 2.3.1.26, RP11-215I23.2, STATSOAT, sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1, sterol O-acyltransferase 1 | |
| SOAT1 | |
| IgG | |
| 65 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P35610 | |
| 6646 | |
| Synthetic peptide directed towards the middle region of human SOAT1 (NP_003092). Peptide sequence ASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title