ACAT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180547

Catalog No. NBP180547

Description

ACAT Polyclonal specifically detects ACAT in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ACAT
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ACACT, ACACT1, ACAT-1, ACATACAT1, acyl-Coenzyme A: cholesterol acyltransferase, Acyl-coenzyme A:cholesterol acyltransferase 1, Cholesterol acyltransferase 1, EC 2.3.1.26, RP11-215I23.2, STATSOAT, sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1, sterol O-acyltransferase 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 65 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 6646
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P35610
• Gene Symbols: SOAT1
• Immunogen: Synthetic peptide directed towards the middle region of human SOAT1 (NP_003092). Peptide sequence ASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Guinea pig: 92%; Equine: 92%; Chicken: 85%; Mouse: 85%; Rat: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG