Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ACBD3 Antibody, Novus Biologicals™

ACBD3 Antibody, Novus Biologicals™
SDP

Catalog No. NB433003 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB433003 25 μL
NBP183379 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB433003 Supplier Novus Biologicals Supplier No. NBP18337925UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 2 publications

ACBD3 Polyclonal specifically detects ACBD3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen ACBD3
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias acyl-CoA binding domain containing 3, Acyl-CoA-binding domain-containing protein 3, acyl-Coenzyme A binding domain containing 3, GCP60Golgi phosphoprotein 1, GOCAP1Peripheral benzodiazepine receptor-associated protein PAP7, golgi complex associated protein 1, 60kDa, Golgi complex-associated protein 1, Golgi resident protein GCP60, GOLPH1PBR- and PKA-associated protein 7, PAP7, PBR associated protein, peripherial benzodiazepine receptor associated protein, PKA (RIalpha)-associated protein
Gene Symbols ACBD3
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVIT
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Golgi Apparatus Markers
Primary or Secondary Primary
Gene ID (Entrez) 64746
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.