Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ACBD7 Antibody, Novus Biologicals™

ACBD7 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15652720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15652720 20 μL
NBP156527 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15652720 Supplier Novus Biologicals Supplier No. NBP15652720UL

Description

Rabbit Polyclonal Antibody

ACBD7 Polyclonal specifically detects ACBD7 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen ACBD7
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8N6N7
Gene Alias acyl-CoA binding domain containing 7, acyl-CoA-binding domain-containing protein 7, acyl-Coenzyme A binding domain containing 7, bA455B2.2, FLJ38219, FLJ52263, MGC33893
Gene Symbols ACBD7
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ACBD7(acyl-Coenzyme A binding domain containing 7) The peptide sequence was selected from the N terminal of ACBD7 (NP_001034933). Peptide sequence MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLD.
Molecular Weight of Antigen 10 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 414149
Target Species Human, Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.