Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ACD Antibody, Novus Biologicals™
SDP

Catalog No. NB8021220UL Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB8021220UL 20 μL
NBP180212 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB8021220UL Supplier Novus Biologicals Supplier No. NBP18021220UL

Rabbit Polyclonal Antibody

ACD Polyclonal specifically detects ACD in Mouse samples. It is validated for Western Blot.

Specifications

Antigen ACD
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_001012656
Gene Alias adrenocortical dysplasia homolog (mouse), Pip1, PIP1Tint1, POT1 and TIN2 organizing protein, POT1 and TIN2-interacting protein, Ptop, PTOPTpp1, TIN2 interacting protein 1, TINT1adrenocortical dysplasia protein homolog, TPP1
Gene Symbols Acd
Host Species Rabbit
Immunogen Synthetic peptide directed towards the c terminal of mouse Acd. Peptide sequence PRTSAQELCSVWEPPERHRDTSAFQYKYETPSASLHTQVQTARLSPQLVA.
Molecular Weight of Antigen 45 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 65057
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.