Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ACD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	ACD
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15315420 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15315420UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP153154 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP153154	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ACD Polyclonal specifically detects ACD in Human samples. It is validated for Western Blot.

Specifications

Antigen	ACD
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q96AP0
Gene ID (Entrez)	65057
Immunogen	Synthetic peptides corresponding to ACD(adrenocortical dysplasia homolog (mouse)) The peptide sequence was selected from the middle region of ACD (NP_001075955). Peptide sequence KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	adrenocortical dysplasia homolog (mouse), Pip1, PIP1Tint1, POT1 and TIN2 organizing protein, POT1 and TIN2-interacting protein, Ptop, PTOPTpp1, TIN2 interacting protein 1, TINT1adrenocortical dysplasia protein homolog, TPP1
Gene Symbols	ACD
Isotype	IgG
Molecular Weight of Antigen	58 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ACD Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents