ACE/CD143 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25720725UL

Catalog No. NB394076

Description

ACE/CD143 Polyclonal specifically detects ACE/CD143 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ACE/CD143
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: ACE1angiotensin converting enzyme, somatic isoform, angiotensin I converting enzyme (peptidyl-dipeptidase A) 1, carboxycathepsin, CD143, CD143 antigen, DCP, DCP1angiotensin-converting enzyme, dipeptidyl carboxypeptidase 1, Dipeptidyl carboxypeptidase I, EC 3.2.1.-, EC 3.4.15.1, Kininase II, MGC26566, MVCD3, peptidase P, testicular ECA
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1636
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ACE
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KTATCWSLDPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDLEHLYQQ
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only