Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACE/CD143 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | ACE/CD143 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ACE/CD143 Polyclonal specifically detects ACE/CD143 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
ACE/CD143 | |
Polyclonal | |
Rabbit | |
Human | |
ACE1angiotensin converting enzyme, somatic isoform, angiotensin I converting enzyme (peptidyl-dipeptidase A) 1, carboxycathepsin, CD143, CD143 antigen, DCP, DCP1angiotensin-converting enzyme, dipeptidyl carboxypeptidase 1, Dipeptidyl carboxypeptidase I, EC 3.2.1.-, EC 3.4.15.1, Kininase II, MGC26566, MVCD3, peptidase P, testicular ECA | |
ACE | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
1636 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KTATCWSLDPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDLEHLYQQ | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title