Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15731320UL
Description
ACF Polyclonal specifically detects ACF in Human samples. It is validated for Western Blot.Specifications
ACF | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9NQ94-2 | |
A1CF | |
Synthetic peptides corresponding to A1CF(APOBEC1 complementation factor) The peptide sequence was selected from the N terminal of A1CF. Peptide sequence MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAA. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
ACF65, ACFASPACF64, apo-B RNA editing protein, APOBEC1 complementation factor, apobec-1 complementation factor (ACF) (ASP), APOBEC-1 stimulating protein, APOBEC1CF, APOBEC1-stimulating protein, MGC163391 | |
Rabbit | |
Affinity Purified | |
RUO | |
29974 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction