Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | ACF |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15731320
|
Novus Biologicals
NBP15731320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP157313
|
Novus Biologicals
NBP157313 |
100 μL |
Each for $487.50
|
|
|||||
Description
ACF Polyclonal specifically detects ACF in Human samples. It is validated for Western Blot.Specifications
| ACF | |
| Polyclonal | |
| Rabbit | |
| Q9NQ94-2 | |
| 29974 | |
| Synthetic peptides corresponding to A1CF(APOBEC1 complementation factor) The peptide sequence was selected from the N terminal of A1CF. Peptide sequence MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ACF65, ACFASPACF64, apo-B RNA editing protein, APOBEC1 complementation factor, apobec-1 complementation factor (ACF) (ASP), APOBEC-1 stimulating protein, APOBEC1CF, APOBEC1-stimulating protein, MGC163391 | |
| A1CF | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title