Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | ACF1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ACF1 Polyclonal specifically detects ACF1 in Human samples. It is validated for Western Blot.Specifications
| ACF1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| ACF1hWALp1, ATP-dependent chromatin remodeling protein, ATP-dependent chromatin-remodeling protein, ATP-utilizing chromatin assembly and remodeling factor 1, bromodomain adjacent to zinc finger domain protein 1A, bromodomain adjacent to zinc finger domain, 1A, CHRAC subunit ACF1, hACF1FLJ14383, WALp1, WCRF180DKFZp586E0518, Williams syndrome transcription factor-related chromatin-remodeling factor 180 | |
| The immunogen is a synthetic peptide directed towards the middle region of human ACF1 (NP_038476). Peptide sequence SLPKRGRPQVRLPVKTRGKLSSSFSSRGQQQEPGRYPSRSQQSTPKTTVS | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 11177 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title