Achaete Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179448

Catalog No. NBP179448

Description

Achaete Polyclonal specifically detects Achaete in Drosophila samples. It is validated for Western Blot.

Specifications

• Antigen: Achaete
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 990 E5 F1, Ac, ac achaete, Ac/Sc, ASC, AS-C T5, AS-C T5ac, ascT5, CG3796, Dmel\CG3796, EG:125H10.3, Hw, sc/T5, T5
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 30981
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_476824
• Gene Symbols: ac
• Immunogen: The specific Immunogen is proprietary information. Peptide sequence FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: House fly: 92%; Blue blowfly: 92%; African malaria mosquito: 85%; Red flour beetle: 85%; Silk moth: 85%; Yellowfever mosquito: 85%; Mosquito: 85%; Harpegnathos saltator: 85%; Camponotus floridanus: 85%; Southern house mosquito: 85%; Caribbean spiny lobster: 85%; Mediterranean fruit fly: 84%; Starlet sea anemone: 83%; Drosophila quadrilineata: 78%; Body louse: 78%; Drosophila sordidula: 78%; Drosophila pavani: 78%; Drosophila paramelanica: 78%; Drosophila nigromelanica: 78%; Drosophila micromelanica: 78%; Drosophila macrospina: 78%; Drosophila gaucha: 78%; Drosophila euronotus: 78%; Drosophila colorata: 78%; Triops longicaudatus: 78%.
• Target Species: Human, Rat, Drosophila
• Isotype: IgG