Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Achaete Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Achaete |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17944820
|
Novus Biologicals
NBP17944820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179448
|
Novus Biologicals
NBP179448 |
100 μL |
Each for $487.50
|
|
|||||
Description
Achaete Polyclonal specifically detects Achaete in Drosophila samples. It is validated for Western Blot.Specifications
| Achaete | |
| Polyclonal | |
| Rabbit | |
| NP_476824 | |
| 30981 | |
| The specific Immunogen is proprietary information. Peptide sequence FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 990 E5 F1, Ac, ac achaete, Ac/Sc, ASC, AS-C T5, AS-C T5ac, ascT5, CG3796, Dmel\CG3796, EG:125H10.3, Hw, sc/T5, T5 | |
| ac | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title