Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Achaete Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17944820UL
Description
Achaete Polyclonal specifically detects Achaete in Drosophila samples. It is validated for Western Blot.Specifications
Achaete | |
Polyclonal | |
Western Blot 1:1000 | |
NP_476824 | |
ac | |
The specific Immunogen is proprietary information. Peptide sequence FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA. | |
20 μL | |
Primary | |
Drosophila | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
990 E5 F1, Ac, ac achaete, Ac/Sc, ASC, AS-C T5, AS-C T5ac, ascT5, CG3796, Dmel\CG3796, EG:125H10.3, Hw, sc/T5, T5 | |
Rabbit | |
Affinity Purified | |
RUO | |
30981 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction