Aconitase 1 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP187677	0.1 mL
NB406005	25 μL

Catalog No. NBP187677 Supplier Novus Biologicals Supplier No. NBP187677

Description

Rabbit Polyclonal Antibody has been used in 2 publications

Aconitase 1 Polyclonal specifically detects Aconitase 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Aconitase 1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 0.25 - 2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Aconitase, aconitase 1, soluble, aconitate hydratase, Citrate hydro-lyase, cytoplasmic aconitate hydratase, EC 4.2.1, EC 4.2.1.3, Ferritin repressor protein, IREB1IREBP1, IREBP, IRE-BP 1, Iron regulatory protein 1, iron-responsive element binding protein 1, Iron-responsive element-binding protein 1, IRP1ACONS
• Gene Symbols: ACO1
• Host Species: Rabbit
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
• Purification Method: Affinity Purified
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Research Discipline: metabolism
• Primary or Secondary: Primary
• Gene ID (Entrez): 48
• Test Specificity: Specificity of human Aconitase 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only