ACOT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP254709

Catalog No. NBP254709

Description

ACOT1 Polyclonal specifically detects ACOT1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ACOT1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1 - 4ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: ACH2, acyl-CoA thioesterase 1Long chain acyl-CoA thioester hydrolase, acyl-coenzyme A thioesterase 1, CTE1, CTE-1, CTE-I, CTE-Ib, EC 3.1.2.2, Inducible cytosolic acyl-coenzyme A thioester hydrolase, LACH2, Long chain acyl-CoA hydrolase
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 641371
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ACOT1
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.