ACP6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154870

Catalog No. NBP154870

Description

ACP6 Polyclonal specifically detects ACP6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ACP6
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NPH0
• Gene Symbols: ACP6
• Immunogen: Synthetic peptides corresponding to ACP6(acid phosphatase 6, lysophosphatidic) The peptide sequence was selected from the N terminal of ACP6. Peptide sequence EADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVEWNPQLLEVPP.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Guinea pig: 86%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: acid phosphatase 6, lysophosphatidicPACPL1, Acid phosphatase-like protein 1, ACPL1acid phosphatase like 1, EC 3.1.3.2, LPAPlysophosphatidic acid phosphatase type 6
• Host Species: Rabbit
• Molecular Weight of Antigen: 49 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 51205
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.