Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACP6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154870
Description
ACP6 Polyclonal specifically detects ACP6 in Human samples. It is validated for Western Blot.Specifications
ACP6 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
acid phosphatase 6, lysophosphatidicPACPL1, Acid phosphatase-like protein 1, ACPL1acid phosphatase like 1, EC 3.1.3.2, LPAPlysophosphatidic acid phosphatase type 6 | |
Rabbit | |
49 kDa | |
100 μL | |
Lipid and Metabolism | |
51205 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9NPH0 | |
ACP6 | |
Synthetic peptides corresponding to ACP6(acid phosphatase 6, lysophosphatidic) The peptide sequence was selected from the N terminal of ACP6. Peptide sequence EADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVEWNPQLLEVPP. | |
Affinity purified | |
RUO | |
Primary | |
Guinea pig: 86%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction