Learn More
Description
Specifications
Specifications
| Antigen | ACSL1 |
| Applications | Western Blot, Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | ACS1LACS 2, Acyl-CoA synthetase 1, acyl-CoA synthetase long-chain family member 1, EC 6.2.1, FACL1EC 6.2.1.3, fatty-acid-Coenzyme A ligase, long-chain 1, LACS 1, LACSlong-chain 2, lignoceroyl-CoA synthase, Long-chain acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 2, Long-chain fatty acid-CoA ligase 2, long-chain fatty-acid-coenzyme A ligase 1, long-chain-fatty-acid--CoA ligase 1, Palmitoyl-CoA ligase 1, Palmitoyl-CoA ligase 2, paltimoyl-CoA ligase 1 |
| Host Species | Rabbit |
| Immunogen | This antibody has been engineered to specifically recognize the recombinant protein ACSL1 using the following amino acid sequence: IIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQRCGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICFTSGTTGNPKGAMVTHRN |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
