Learn More
Description
Specifications
Specifications
| Antigen | ACSL5 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | CL0275 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS (pH 7.2), 40% Glycerol |
| Gene Alias | ACS2, ACS5FACL5 for fatty acid coenzyme A ligase 5, acyl-CoA synthetase long-chain family member 5, EC 6.2.1, EC 6.2.1.3, FACL5fatty acid coenzyme A ligase 5, fatty-acid-Coenzyme A ligase, long-chain 5, LACS 5, Long-chain acyl-CoA synthetase 5, long-chain fatty acid coenzyme A ligase 5, long-chain-fatty-acid--CoA ligase 5 |
| Host Species | Mouse |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
