ACTL6B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155478

Catalog No. NBP155478

Description

ACTL6B Polyclonal specifically detects ACTL6B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ACTL6B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 53 kDa BRG1-associated factor B, actin-like 6, actin-like 6B, Actin-related protein Baf53b, ACTL6, ArpNalpha, BAF53Bactin-like protein 6B, BRG1-associated factor 53B, hArpN alpha
• Host Species: Rabbit
• Molecular Weight of Antigen: 47 kDa
• Quantity: 100 μL
• Research Discipline: Extracellular Matrix
• Gene ID (Entrez): 51412
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O94805
• Gene Symbols: ACTL6B
• Immunogen: Synthetic peptides corresponding to ACTL6B(actin-like 6B) The peptide sequence was selected from the middle region of ACTL6B. Peptide sequence GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.