Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACTL6B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$493.10
Specifications
| Antigen | ACTL6B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ACTL6B Polyclonal specifically detects ACTL6B in Human samples. It is validated for Western Blot.Specifications
| ACTL6B | |
| Polyclonal | |
| Rabbit | |
| Extracellular Matrix | |
| 53 kDa BRG1-associated factor B, actin-like 6, actin-like 6B, Actin-related protein Baf53b, ACTL6, ArpNalpha, BAF53Bactin-like protein 6B, BRG1-associated factor 53B, hArpN alpha | |
| ACTL6B | |
| IgG | |
| 47 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O94805 | |
| 51412 | |
| Synthetic peptides corresponding to ACTL6B(actin-like 6B) The peptide sequence was selected from the middle region of ACTL6B. Peptide sequence GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title