Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ADAM23 Antibody, Novus Biologicals™

ADAM23 Antibody, Novus Biologicals™
SDP

Catalog No. NBP169016 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP169016 100 μL
NBP16901620 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP169016 Supplier Novus Biologicals Supplier No. NBP169016
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ADAM23 Polyclonal specifically detects ADAM23 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen ADAM23
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9R1V7
Gene Alias a disintegrin and metalloproteinase domain 23, ADAM metallopeptidase domain 23, disintegrin and metalloproteinase domain-containing protein 23, MDC-3, MDC3ADAM 23, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3
Gene Symbols ADAM23
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Adam23 (a disintegrin and metallopeptidase domain 23) The peptide sequence was selected from the C terminal of Adam23. Peptide sequence NPNPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFD.
Molecular Weight of Antigen 25 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8745
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Bovine, Canine, Equine, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.