ADAMTS4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154369

Catalog No. NBP154369

Description

ADAMTS4 Polyclonal specifically detects ADAMTS4 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ADAMTS4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 4, ADAM metallopeptidase with thrombospondin type 1 motif, 4, ADAM-TS 4, ADAMTS-2, ADAM-TS4, ADAMTS-4, ADMP-1EC 3.4.24.82, aggrecanase-1, EC 3.4.24, KIAA0688A disintegrin and metalloproteinase with thrombospondin motifs 4
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, GPCR, Neuroscience, Vision
• Gene ID (Entrez): 9507
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
• Gene Accession No.: O75173
• Gene Symbols: ADAMTS4
• Immunogen: Synthetic peptides corresponding to ADAMTS4(ADAM metallopeptidase with thrombospondin type 1 motif, 4) The peptide sequence was selected from the N terminal of ADAMTS4 (AAH30812). Peptide sequence GVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only