ADAMTS6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179877

Catalog No. NBP179877

Description

ADAMTS6 Polyclonal specifically detects ADAMTS6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ADAMTS6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ADAM metallopeptidase with thrombospondin type 1 motif, 66,EC 3.4.24.-, ADAM-TS 6, ADAMTS-6, EC 3.4.24.82
• Host Species: Rabbit
• Molecular Weight of Antigen: 96 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UKP5
• Gene Symbols: ADAMTS6
• Immunogen: Synthetic peptide corresponding to a.a. 563-897 of Human ADAMTS6 (NP_922932). Peptide Sequence: PWSECSATCAGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRACNTE
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11174
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.