Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADAMTS6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ADAMTS6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ADAMTS6 Polyclonal specifically detects ADAMTS6 in Human samples. It is validated for Western Blot.Specifications
ADAMTS6 | |
Polyclonal | |
Rabbit | |
Q9UKP5 | |
11174 | |
Synthetic peptide corresponding to a.a. 563-897 of Human ADAMTS6 (NP_922932). Peptide Sequence: PWSECSATCAGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRACNTE | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ADAM metallopeptidase with thrombospondin type 1 motif, 66,EC 3.4.24.-, ADAM-TS 6, ADAMTS-6, EC 3.4.24.82 | |
ADAMTS6 | |
IgG | |
96 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title