Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADAMTS6 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ADAMTS6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179877
|
Novus Biologicals
NBP179877 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ADAMTS6 Polyclonal specifically detects ADAMTS6 in Human samples. It is validated for Western Blot.Specifications
| ADAMTS6 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ADAM metallopeptidase with thrombospondin type 1 motif, 66,EC 3.4.24.-, ADAM-TS 6, ADAMTS-6, EC 3.4.24.82 | |
| ADAMTS6 | |
| IgG | |
| Affinity Purified | |
| 96 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UKP5 | |
| 11174 | |
| Synthetic peptide corresponding to a.a. 563-897 of Human ADAMTS6 (NP_922932). Peptide Sequence: PWSECSATCAGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRACNTE | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title