Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ADAMTS7 Antibody, Novus Biologicals™

ADAMTS7 Antibody, Novus Biologicals™
SDP

Catalog No. NB396777 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396777 25 μL
NBP238539 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB396777 Supplier Novus Biologicals Supplier No. NBP23853925UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 1 publication

ADAMTS7 Polyclonal specifically detects ADAMTS7 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen ADAMTS7
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9UKP4
Gene Alias A disintegrin and metalloproteinase with thrombospondin motifs 7, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 7, ADAM metallopeptidase with thrombospondin type 1 motif, 7, ADAM-TS 7, ADAMTS-7, ADAM-TS7a disintegrin and metalloprotease with thrombospondin motifs-7 preproprotein, COMPase, DKFZp434H204, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.82
Gene Symbols ADAMTS7
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LGRAHIRAHTPACHLLGEVQDSELEGGLAAISACDGLKGVFLLSN
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11173
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.