ADAMTS8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24948025UL

Catalog No. NB395665

Description

ADAMTS8 Polyclonal antibody specifically detects ADAMTS8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: ADAMTS8
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 8, ADAM metallopeptidase with thrombospondin type 1 motif, 8, ADAMTS-8, ADAM-TS8A disintegrin and metalloproteinase with thrombospondin motifs 8, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.14, EC 3.4.24.82, FLJ41712, METH-2, METH2ADAM-TS 8, METH-8
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SIATLERLQSFRPLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVL
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 11095
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified