Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADAMTS8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00
Specifications
| Antigen | ADAMTS8 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ADAMTS8 Polyclonal antibody specifically detects ADAMTS8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| ADAMTS8 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS (pH 7.2), 40% Glycerol | |
| 11095 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 8, ADAM metallopeptidase with thrombospondin type 1 motif, 8, ADAMTS-8, ADAM-TS8A disintegrin and metalloproteinase with thrombospondin motifs 8, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.14, EC 3.4.24.82, FLJ41712, METH-2, METH2ADAM-TS 8, METH-8 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SIATLERLQSFRPLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVL | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title