ADAR Rabbit anti-Human, Mouse, Rat, Clone: 7H1U2, Novus Biologicals™

Rabbit Monoclonal Antibody

Supplier:  Novus Biologicals NBP31538320UL

Catalog No. NB165863

Description

ADAR Monoclonal antibody specifically detects ADAR in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: ADAR
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 103
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Clone: 7H1U2
• Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
• Gene Alias: ADAR1DSH, adenosine deaminase, RNA-specific, DRADAP136, DSRADadenosine deaminase acting on RNA 1-A, EC 3.5.4, EC 3.5.4.-, G1P1double-stranded RNA-specific adenosine deaminase, IFI-4, IFI4dsRNA adenosine deaminase, interferon-induced protein 4, Interferon-inducible protein 4, K88DSRBP, p136,136 kDa double-stranded RNA-binding protein
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human ADAR (P55265). STQAWNQHSGVVRPDGHSQGAPNSDPSLEPEDRNSTSVSEDLLEPFIAVSAQAWNQHSGVVRPDSHSQGSPNSDPGLEPEDSNSTSALEDPLEFLDMAEIK
• Quantity: 20 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified