ADAT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23173225UL

Catalog No. NB404859

Description

ADAT3 Polyclonal specifically detects ADAT3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ADAT3
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q96EY9
• Gene Symbols: ADAT3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLD
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: adenosine deaminase, tRNA-specific 3, TAD3 homolog (S. cerevisiae), FWP005, MST121, MSTP121, S863-5, TAD3, tRNA-specific adenosine deaminase 3 homolog, tRNA-specific adenosine deaminase-like protein 3, tRNA-specific adenosine-34 deaminase subunit ADAT3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 113179
• Target Species: Human
• Isotype: IgG

For Research Use Only