Adenosine Deaminase 2/CECR1 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP159343	100 μL

Catalog No. NBP159343 Supplier Novus Biologicals Supplier No. NBP159343

Description

Rabbit Polyclonal Antibody

Adenosine Deaminase 2/CECR1 Polyclonal specifically detects Adenosine Deaminase 2/CECR1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Adenosine Deaminase 2/CECR1
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q9NZK5
• Gene Alias: ADA2, adenosine deaminase CECR1, ADGFadenosine deaminase 2, cat eye syndrome chromosome region, candidate 1, Cat eye syndrome critical region protein 1, CECR2, EC 3.5.4.4, IDGFL
• Gene Symbols: CECR1
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to CECR1(cat eye syndrome chromosome region, candidate 1) The peptide sequence was selected from the N terminal of CECR1. Peptide sequence MQFRFAHPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHP.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Gene ID (Entrez): 51816
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only